Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1222897..1223536 | Replicon | chromosome |
Accession | NZ_LS483438 | ||
Organism | Haemophilus influenzae strain NCTC12975 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q4QJX7 |
Locus tag | DQN45_RS06010 | Protein ID | WP_005650215.1 |
Coordinates | 1222897..1223202 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DQN45_RS06015 | Protein ID | WP_005650217.1 |
Coordinates | 1223213..1223536 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN45_RS05990 | 1218327..1220366 | - | 2040 | WP_038441065.1 | excinuclease ABC subunit B | - |
DQN45_RS06000 | 1220981..1221949 | - | 969 | WP_042593950.1 | zinc transporter permease subunit ZevB | - |
DQN45_RS06005 | 1221952..1222572 | - | 621 | WP_005694310.1 | zinc transporter binding subunit ZevA | - |
DQN45_RS06010 | 1222897..1223202 | + | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN45_RS06015 | 1223213..1223536 | + | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
DQN45_RS06020 | 1223699..1225369 | + | 1671 | WP_005650218.1 | energy-dependent translational throttle protein EttA | - |
DQN45_RS06025 | 1225431..1225772 | + | 342 | WP_005652996.1 | SirB2 family protein | - |
DQN45_RS06030 | 1225777..1227747 | + | 1971 | WP_011961904.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
DQN45_RS09215 | 1227744..1227917 | + | 174 | WP_011272700.1 | DUF5363 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T292570 WP_005650215.1 NZ_LS483438:1222897-1223202 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|