Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA-HipA |
Location | 379113..380461 | Replicon | chromosome |
Accession | NZ_LS483438 | ||
Organism | Haemophilus influenzae strain NCTC12975 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | - |
Locus tag | DQN45_RS01885 | Protein ID | WP_042593553.1 |
Coordinates | 379430..380461 (+) | Length | 344 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A2S9R6P7 |
Locus tag | DQN45_RS01880 | Protein ID | WP_005650823.1 |
Coordinates | 379113..379433 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN45_RS01840 | 374540..374818 | + | 279 | WP_042593548.1 | cell division protein FtsB | - |
DQN45_RS01845 | 374818..375495 | + | 678 | WP_042593549.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
DQN45_RS01850 | 375492..375968 | + | 477 | WP_005687916.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
DQN45_RS01855 | 376273..376707 | - | 435 | WP_013526377.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
DQN45_RS01860 | 376704..377144 | - | 441 | WP_005694621.1 | FMN-binding protein MioC | - |
DQN45_RS01865 | 377241..377459 | - | 219 | WP_005650820.1 | cell division protein ZapB | - |
DQN45_RS01870 | 377621..378622 | + | 1002 | WP_005690169.1 | class II fructose-bisphosphatase | - |
DQN45_RS01875 | 378817..379125 | + | 309 | WP_005661200.1 | helix-turn-helix domain-containing protein | - |
DQN45_RS01880 | 379113..379433 | + | 321 | WP_005650823.1 | type II toxin-antitoxin system HipA family toxin | Antitoxin |
DQN45_RS01885 | 379430..380461 | + | 1032 | WP_042593553.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
DQN45_RS01890 | 380545..382203 | - | 1659 | WP_042593554.1 | thiol reductant ABC exporter subunit CydC | - |
DQN45_RS01895 | 382196..383941 | - | 1746 | WP_042593556.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 344 a.a. Molecular weight: 39870.45 Da Isoelectric Point: 6.6398
>T292567 WP_042593553.1 NZ_LS483438:379430-380461 [Haemophilus influenzae]
MNFCRILLKPLKKNEVHSGYSTKGLHYLTGNKNFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDEHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQTEIHQEQLDGAMNIRDK
YGKIGADNEQYVSYERVAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEIIQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNVLHEPEL
MNFCRILLKPLKKNEVHSGYSTKGLHYLTGNKNFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDEHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQTEIHQEQLDGAMNIRDK
YGKIGADNEQYVSYERVAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEIIQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNVLHEPEL
Download Length: 1032 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|