Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1666986..1667625 | Replicon | chromosome |
Accession | NZ_LS483429 | ||
Organism | Haemophilus aegyptius strain NCTC8502 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q4QJX7 |
Locus tag | DQN49_RS08720 | Protein ID | WP_005650215.1 |
Coordinates | 1667320..1667625 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DQN49_RS08715 | Protein ID | WP_005650217.1 |
Coordinates | 1666986..1667309 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN49_RS10250 | 1662606..1662779 | - | 174 | WP_005657572.1 | DUF5363 domain-containing protein | - |
DQN49_RS08700 | 1662776..1664746 | - | 1971 | WP_006995880.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
DQN49_RS08705 | 1664751..1665092 | - | 342 | WP_006995879.1 | SirB2 family protein | - |
DQN49_RS08710 | 1665153..1666823 | - | 1671 | WP_005663485.1 | energy-dependent translational throttle protein EttA | - |
DQN49_RS08715 | 1666986..1667309 | - | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
DQN49_RS08720 | 1667320..1667625 | - | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN49_RS08725 | 1667950..1668570 | + | 621 | WP_005694310.1 | zinc transporter binding subunit ZevA | - |
DQN49_RS08730 | 1668573..1669547 | + | 975 | WP_006995878.1 | zinc transporter permease subunit ZevB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T292561 WP_005650215.1 NZ_LS483429:c1667625-1667320 [Haemophilus aegyptius]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|