Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 1632221..1632864 | Replicon | chromosome |
| Accession | NZ_LS483429 | ||
| Organism | Haemophilus aegyptius strain NCTC8502 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | DQN49_RS08565 | Protein ID | WP_006995912.1 |
| Coordinates | 1632221..1632559 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DQN49_RS08570 | Protein ID | WP_006995911.1 |
| Coordinates | 1632556..1632864 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN49_RS08540 | 1627831..1628202 | + | 372 | WP_006995917.1 | hypothetical protein | - |
| DQN49_RS08545 | 1628192..1628395 | + | 204 | WP_006995916.1 | hypothetical protein | - |
| DQN49_RS08550 | 1628382..1629065 | + | 684 | WP_006995915.1 | hypothetical protein | - |
| DQN49_RS08555 | 1629058..1629450 | + | 393 | WP_006995914.1 | hypothetical protein | - |
| DQN49_RS08560 | 1629438..1631630 | + | 2193 | WP_006995913.1 | DUF927 domain-containing protein | - |
| DQN49_RS08565 | 1632221..1632559 | + | 339 | WP_006995912.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN49_RS08570 | 1632556..1632864 | + | 309 | WP_006995911.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DQN49_RS08575 | 1633195..1633714 | - | 520 | Protein_1638 | DDE-type integrase/transposase/recombinase | - |
| DQN49_RS08580 | 1633786..1634460 | - | 675 | WP_006995908.1 | N-acylneuraminate cytidylyltransferase | - |
| DQN49_RS08585 | 1634574..1635236 | + | 663 | WP_006995907.1 | NAD(P)H-dependent oxidoreductase | - |
| DQN49_RS08590 | 1635275..1635628 | - | 354 | WP_006995906.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQN49_RS08595 | 1635628..1635897 | - | 270 | WP_006995905.1 | hypothetical protein | - |
| DQN49_RS08600 | 1636120..1637232 | - | 1113 | WP_006995904.1 | iron-sulfur cluster carrier protein ApbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13134.05 Da Isoelectric Point: 9.2488
>T292560 WP_006995912.1 NZ_LS483429:1632221-1632559 [Haemophilus aegyptius]
VKLSFIELPPFERYRKAHLSDDEYRAFQNELLENPEKGDVIQNAGGLRKIRIADSERNKGKRGGARVIYYYLIRKSQILL
VTAYSKNRCEDLTTEQYKILAKLVKEIEELEQ
VKLSFIELPPFERYRKAHLSDDEYRAFQNELLENPEKGDVIQNAGGLRKIRIADSERNKGKRGGARVIYYYLIRKSQILL
VTAYSKNRCEDLTTEQYKILAKLVKEIEELEQ
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|