292547

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 828035..828605 Replicon chromosome
Accession NZ_LS483423
Organism Jonesia denitrificans strain NCTC10816

Toxin (Protein)


Gene name graT Uniprot ID C7R1W2
Locus tag DQN74_RS03860 Protein ID WP_015771058.1
Coordinates 828035..828316 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DQN74_RS03865 Protein ID WP_015771059.1
Coordinates 828303..828605 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN74_RS03815 823443..823847 - 405 WP_041288145.1 hypothetical protein -
DQN74_RS03820 823893..824237 - 345 WP_015771049.1 hypothetical protein -
DQN74_RS13000 824230..824427 - 198 WP_015771050.1 hypothetical protein -
DQN74_RS03830 824855..825307 - 453 WP_015771052.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
DQN74_RS03835 825448..825810 - 363 WP_015771053.1 hypothetical protein -
DQN74_RS03840 825846..826073 - 228 WP_015771054.1 hypothetical protein -
DQN74_RS03845 826164..826499 - 336 WP_015771055.1 hypothetical protein -
DQN74_RS03850 826604..827593 - 990 WP_015771056.1 SRPBCC domain-containing protein -
DQN74_RS03855 827590..827835 - 246 WP_015771057.1 hypothetical protein -
DQN74_RS03860 828035..828316 + 282 WP_015771058.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQN74_RS03865 828303..828605 + 303 WP_015771059.1 HigA family addiction module antidote protein Antitoxin
DQN74_RS03870 828602..829117 + 516 WP_015771060.1 GNAT family N-acetyltransferase -
DQN74_RS03875 829207..829593 - 387 WP_015771061.1 hypothetical protein -
DQN74_RS03880 829631..829918 - 288 WP_015771062.1 transcriptional regulator -
DQN74_RS03885 829920..830240 - 321 WP_143713239.1 hypothetical protein -
DQN74_RS03890 830326..830601 + 276 WP_197713011.1 type II toxin-antitoxin system RelE/ParE family toxin -
DQN74_RS03895 830723..831376 + 654 WP_015771065.1 hypothetical protein -
DQN74_RS03900 831819..832687 + 869 Protein_753 NAD(P)-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 818111..836535 18424
- inside Genomic island - - 817402..836535 19133


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(24-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10927.43 Da        Isoelectric Point: 10.9360

>T292547 WP_015771058.1 NZ_LS483423:828035-828316 [Jonesia denitrificans]
VIRSFGDKETERLWRRERVRSIDPRIHRVALRKLRQVGSAESIEDLRVPPGNRLEALKGNRSGQHSIRINDQWRICFVWT
AAGPEEVQIVDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11063.60 Da        Isoelectric Point: 4.8129

>AT292547 WP_015771059.1 NZ_LS483423:828303-828605 [Jonesia denitrificans]
MTTTDKIEPIHPGEVLMEDFIEGFGITQNKLAVSIGVPPRRINEIVHGKRGITADTALRLAKYFGTSAEFWINLQSHYEL
DRAEDLAGEQIASITPLQVA

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C7R1W2

Antitoxin

Source ID Structure

References