Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 828035..828605 | Replicon | chromosome |
| Accession | NZ_LS483423 | ||
| Organism | Jonesia denitrificans strain NCTC10816 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | C7R1W2 |
| Locus tag | DQN74_RS03860 | Protein ID | WP_015771058.1 |
| Coordinates | 828035..828316 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DQN74_RS03865 | Protein ID | WP_015771059.1 |
| Coordinates | 828303..828605 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN74_RS03815 | 823443..823847 | - | 405 | WP_041288145.1 | hypothetical protein | - |
| DQN74_RS03820 | 823893..824237 | - | 345 | WP_015771049.1 | hypothetical protein | - |
| DQN74_RS13000 | 824230..824427 | - | 198 | WP_015771050.1 | hypothetical protein | - |
| DQN74_RS03830 | 824855..825307 | - | 453 | WP_015771052.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| DQN74_RS03835 | 825448..825810 | - | 363 | WP_015771053.1 | hypothetical protein | - |
| DQN74_RS03840 | 825846..826073 | - | 228 | WP_015771054.1 | hypothetical protein | - |
| DQN74_RS03845 | 826164..826499 | - | 336 | WP_015771055.1 | hypothetical protein | - |
| DQN74_RS03850 | 826604..827593 | - | 990 | WP_015771056.1 | SRPBCC domain-containing protein | - |
| DQN74_RS03855 | 827590..827835 | - | 246 | WP_015771057.1 | hypothetical protein | - |
| DQN74_RS03860 | 828035..828316 | + | 282 | WP_015771058.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQN74_RS03865 | 828303..828605 | + | 303 | WP_015771059.1 | HigA family addiction module antidote protein | Antitoxin |
| DQN74_RS03870 | 828602..829117 | + | 516 | WP_015771060.1 | GNAT family N-acetyltransferase | - |
| DQN74_RS03875 | 829207..829593 | - | 387 | WP_015771061.1 | hypothetical protein | - |
| DQN74_RS03880 | 829631..829918 | - | 288 | WP_015771062.1 | transcriptional regulator | - |
| DQN74_RS03885 | 829920..830240 | - | 321 | WP_143713239.1 | hypothetical protein | - |
| DQN74_RS03890 | 830326..830601 | + | 276 | WP_197713011.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DQN74_RS03895 | 830723..831376 | + | 654 | WP_015771065.1 | hypothetical protein | - |
| DQN74_RS03900 | 831819..832687 | + | 869 | Protein_753 | NAD(P)-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 818111..836535 | 18424 | |
| - | inside | Genomic island | - | - | 817402..836535 | 19133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10927.43 Da Isoelectric Point: 10.9360
>T292547 WP_015771058.1 NZ_LS483423:828035-828316 [Jonesia denitrificans]
VIRSFGDKETERLWRRERVRSIDPRIHRVALRKLRQVGSAESIEDLRVPPGNRLEALKGNRSGQHSIRINDQWRICFVWT
AAGPEEVQIVDYH
VIRSFGDKETERLWRRERVRSIDPRIHRVALRKLRQVGSAESIEDLRVPPGNRLEALKGNRSGQHSIRINDQWRICFVWT
AAGPEEVQIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|