Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1504107..1504762 | Replicon | chromosome |
Accession | NZ_LS483422 | ||
Organism | Providencia heimbachae strain NCTC12003 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4D7IZ57 |
Locus tag | DQN80_RS06540 | Protein ID | WP_068909942.1 |
Coordinates | 1504107..1504463 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1B7JJ80 |
Locus tag | DQN80_RS06545 | Protein ID | WP_068909944.1 |
Coordinates | 1504463..1504762 (+) | Length | 100 a.a. |
Genomic Context
Location: 1499682..1500722 (1041 bp)
Type: Others
Protein ID: WP_068909938.1
Type: Others
Protein ID: WP_068909938.1
Location: 1500919..1501917 (999 bp)
Type: Others
Protein ID: WP_068445556.1
Type: Others
Protein ID: WP_068445556.1
Location: 1502163..1503794 (1632 bp)
Type: Others
Protein ID: WP_068909940.1
Type: Others
Protein ID: WP_068909940.1
Location: 1504107..1504463 (357 bp)
Type: Toxin
Protein ID: WP_068909942.1
Type: Toxin
Protein ID: WP_068909942.1
Location: 1504463..1504762 (300 bp)
Type: Antitoxin
Protein ID: WP_068909944.1
Type: Antitoxin
Protein ID: WP_068909944.1
Location: 1504845..1506299 (1455 bp)
Type: Others
Protein ID: WP_068909946.1
Type: Others
Protein ID: WP_068909946.1
Location: 1506313..1507476 (1164 bp)
Type: Others
Protein ID: WP_068909947.1
Type: Others
Protein ID: WP_068909947.1
Location: 1507532..1508422 (891 bp)
Type: Others
Protein ID: WP_068909949.1
Type: Others
Protein ID: WP_068909949.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN80_RS06525 | 1499682..1500722 | + | 1041 | WP_068909938.1 | galactose-1-epimerase | - |
DQN80_RS06530 | 1500919..1501917 | + | 999 | WP_068445556.1 | substrate-binding domain-containing protein | - |
DQN80_RS06535 | 1502163..1503794 | + | 1632 | WP_068909940.1 | sodium/sugar symporter | - |
DQN80_RS06540 | 1504107..1504463 | + | 357 | WP_068909942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN80_RS06545 | 1504463..1504762 | + | 300 | WP_068909944.1 | helix-turn-helix domain-containing protein | Antitoxin |
DQN80_RS06550 | 1504845..1506299 | - | 1455 | WP_068909946.1 | bifunctional 2-methylcitrate dehydratase/aconitate hydratase | - |
DQN80_RS06555 | 1506313..1507476 | - | 1164 | WP_068909947.1 | 2-methylcitrate synthase | - |
DQN80_RS06560 | 1507532..1508422 | - | 891 | WP_068909949.1 | methylisocitrate lyase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13976.32 Da Isoelectric Point: 9.5588
>T292541 WP_068909942.1 NZ_LS483422:1504107-1504463 [Providencia heimbachae]
MTWKITTRPLFEAWFEEQNEAVQEETLSVLNILREYGPYIGRPQVDTLKDSKYRNMKELRIQVGGHPIRICFVFDPMRKG
VILCAGNKKGHDEKRFYSKLIRLADMEYSIYLKGIYKI
MTWKITTRPLFEAWFEEQNEAVQEETLSVLNILREYGPYIGRPQVDTLKDSKYRNMKELRIQVGGHPIRICFVFDPMRKG
VILCAGNKKGHDEKRFYSKLIRLADMEYSIYLKGIYKI
Download Length: 357 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D7IZ57 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JJ80 |