Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 744331..744901 | Replicon | chromosome |
Accession | NZ_LS483422 | ||
Organism | Providencia heimbachae strain NCTC12003 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1B7JQL3 |
Locus tag | DQN80_RS03215 | Protein ID | WP_068909369.1 |
Coordinates | 744331..744612 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | A0A1B7JQM8 |
Locus tag | DQN80_RS03220 | Protein ID | WP_068439151.1 |
Coordinates | 744623..744901 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN80_RS03195 | 740718..741950 | + | 1233 | WP_068909366.1 | multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR | - |
DQN80_RS03200 | 742025..743692 | - | 1668 | WP_068909368.1 | energy-dependent translational throttle protein EttA | - |
DQN80_RS03215 | 744331..744612 | + | 282 | WP_068909369.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN80_RS03220 | 744623..744901 | + | 279 | WP_068439151.1 | HigA family addiction module antidote protein | Antitoxin |
DQN80_RS03225 | 745111..747027 | + | 1917 | WP_068909371.1 | murein transglycosylase | - |
DQN80_RS03230 | 747207..747524 | + | 318 | WP_068439659.1 | trp operon repressor | - |
DQN80_RS03235 | 747610..748146 | - | 537 | WP_068439155.1 | inosine/xanthosine triphosphatase | - |
DQN80_RS03240 | 748199..748843 | + | 645 | WP_068439157.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB | - |
DQN80_RS03245 | 748890..749822 | - | 933 | WP_068909373.1 | MDR efflux pump AcrAB transcriptional activator RobA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10763.42 Da Isoelectric Point: 10.6271
>T292538 WP_068909369.1 NZ_LS483422:744331-744612 [Providencia heimbachae]
VIKSFKHKGIERFFKTGITSGIQVKHITKLRIQLTALNTAKKPNDMSAPSWKLHQLKGADLQNHWSISVNGNWRLTFKFE
GENVILVDYQDYH
VIKSFKHKGIERFFKTGITSGIQVKHITKLRIQLTALNTAKKPNDMSAPSWKLHQLKGADLQNHWSISVNGNWRLTFKFE
GENVILVDYQDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JQL3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JQM8 |