Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 294630..295143 | Replicon | chromosome |
Accession | NZ_LS483413 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC7136 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | DQN40_RS01610 | Protein ID | WP_084916229.1 |
Coordinates | 294630..294884 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | DQN40_RS01615 | Protein ID | WP_003053797.1 |
Coordinates | 294877..295143 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN40_RS01580 | 290872..291282 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
DQN40_RS01585 | 291285..291509 | - | 225 | WP_003053785.1 | hypothetical protein | - |
DQN40_RS01590 | 291513..292523 | - | 1011 | WP_022554213.1 | conjugal transfer protein | - |
DQN40_RS01595 | 292535..293071 | - | 537 | WP_003053800.1 | hypothetical protein | - |
DQN40_RS01600 | 293098..293328 | - | 231 | WP_003053793.1 | hypothetical protein | - |
DQN40_RS01605 | 293348..294574 | - | 1227 | WP_084916231.1 | replication initiation factor domain-containing protein | - |
DQN40_RS01610 | 294630..294884 | - | 255 | WP_084916229.1 | Txe/YoeB family addiction module toxin | Toxin |
DQN40_RS01615 | 294877..295143 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DQN40_RS01620 | 295408..297093 | - | 1686 | WP_084916228.1 | cell division protein FtsK | - |
DQN40_RS01625 | 297110..297571 | - | 462 | WP_003056467.1 | hypothetical protein | - |
DQN40_RS01630 | 297590..297886 | - | 297 | WP_003056470.1 | hypothetical protein | - |
DQN40_RS01635 | 297926..298171 | - | 246 | WP_003056472.1 | hypothetical protein | - |
DQN40_RS01640 | 298744..299085 | + | 342 | WP_110408064.1 | helix-turn-helix domain-containing protein | - |
DQN40_RS01645 | 299289..299594 | + | 306 | WP_014612001.1 | hypothetical protein | - |
DQN40_RS01650 | 299629..299988 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 270073..327491 | 57418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10502.78 Da Isoelectric Point: 8.4060
>T292524 WP_084916229.1 NZ_LS483413:c294884-294630 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|