Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 273297..273810 Replicon chromosome
Accession NZ_LS483409
Organism Streptococcus gallolyticus strain NCTC13773

Toxin (Protein)


Gene name yoeB Uniprot ID A0A1S5W9N2
Locus tag DQN21_RS01590 Protein ID WP_049533167.1
Coordinates 273297..273551 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag DQN21_RS01595 Protein ID WP_077496080.1
Coordinates 273544..273810 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN21_RS01555 268949..269365 - 417 WP_077496066.1 conjugal transfer protein -
DQN21_RS01560 269367..269594 - 228 WP_077496068.1 hypothetical protein -
DQN21_RS01565 269611..270612 - 1002 WP_077496070.1 conjugal transfer protein -
DQN21_RS01570 270622..271176 - 555 WP_077496072.1 conjugal transfer protein -
DQN21_RS01575 271194..271631 - 438 WP_077496074.1 hypothetical protein -
DQN21_RS01580 271646..272032 - 387 WP_077496076.1 hypothetical protein -
DQN21_RS01585 272010..273242 - 1233 WP_077496078.1 replication initiation factor domain-containing protein -
DQN21_RS01590 273297..273551 - 255 WP_049533167.1 Txe/YoeB family addiction module toxin Toxin
DQN21_RS01595 273544..273810 - 267 WP_077496080.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
DQN21_RS01600 274074..275732 - 1659 WP_077496082.1 cell division protein FtsK -
DQN21_RS01605 275739..276149 - 411 WP_003041912.1 DUF961 family protein -
DQN21_RS01610 276172..276486 - 315 WP_000406626.1 hypothetical protein -
DQN21_RS01615 276601..276828 - 228 WP_077496084.1 TetR family transcriptional regulator -
DQN21_RS01620 276825..277061 - 237 WP_077496086.1 hypothetical protein -
DQN21_RS01625 277190..277468 - 279 WP_077496088.1 type II toxin-antitoxin system YafQ family toxin -
DQN21_RS01630 277469..277741 - 273 WP_077496090.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DQN21_RS01635 278415..278777 + 363 WP_049533221.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 220836..290248 69412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10492.93 Da        Isoelectric Point: 8.3800

>T292509 WP_049533167.1 NZ_LS483409:c273551-273297 [Streptococcus gallolyticus]
MFNFTEQAWKDYVSWQQEDKKILKRINRLIEDIKRNPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYMVEEDEIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10404.98 Da        Isoelectric Point: 5.1486

>AT292509 WP_077496080.1 NZ_LS483409:c273810-273544 [Streptococcus gallolyticus]
MEAVVYSNFRNNLKNYMKKVNDEYEPLMVVNKNPDENIVVLSKENWDSIQETIRLMNNDYLSDKVLSGMEQVKQKKVIQR
PLLEVKDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S5W9N2

Antitoxin

Source ID Structure

References