Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1350210..1350879 | Replicon | chromosome |
| Accession | NZ_LS483392 | ||
| Organism | Haemophilus influenzae strain NCTC11931 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2R3G0F4 |
| Locus tag | DQM65_RS06965 | Protein ID | WP_015701504.1 |
| Coordinates | 1350210..1350593 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A502K5Z3 |
| Locus tag | DQM65_RS06970 | Protein ID | WP_005651224.1 |
| Coordinates | 1350577..1350879 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM65_RS06930 | 1346970..1347293 | + | 324 | WP_059358265.1 | DUF2190 family protein | - |
| DQM65_RS06935 | 1347274..1347585 | + | 312 | WP_015701509.1 | hypothetical protein | - |
| DQM65_RS06940 | 1347588..1348118 | + | 531 | WP_015701508.1 | phage tail protein | - |
| DQM65_RS06945 | 1348127..1348537 | + | 411 | WP_111691593.1 | phage tail protein | - |
| DQM65_RS06950 | 1348540..1349190 | + | 651 | WP_038440702.1 | hypothetical protein | - |
| DQM65_RS06955 | 1349465..1349872 | + | 408 | WP_038440705.1 | hypothetical protein | - |
| DQM65_RS06960 | 1349917..1350141 | + | 225 | WP_038440708.1 | DUF4035 domain-containing protein | - |
| DQM65_RS06965 | 1350210..1350593 | + | 384 | WP_015701504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM65_RS06970 | 1350577..1350879 | + | 303 | WP_005651224.1 | XRE family transcriptional regulator | Antitoxin |
| DQM65_RS06975 | 1350895..1351131 | + | 237 | WP_101494098.1 | hypothetical protein | - |
| DQM65_RS06980 | 1351238..1351369 | + | 132 | WP_111691594.1 | DUF4035 domain-containing protein | - |
| DQM65_RS06985 | 1351433..1351681 | + | 249 | WP_015701502.1 | hypothetical protein | - |
| DQM65_RS06990 | 1351760..1355101 | + | 3342 | WP_111691595.1 | tape measure protein | - |
| DQM65_RS06995 | 1355110..1355445 | + | 336 | WP_111691596.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1283429..1415987 | 132558 | |
| - | inside | Prophage | - | - | 1286941..1415987 | 129046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14868.05 Da Isoelectric Point: 4.4987
>T292488 WP_015701504.1 NZ_LS483392:1350210-1350593 [Haemophilus influenzae]
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2R3G0F4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A502K5Z3 |