Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 2542545..2543068 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | X5DYX7 |
| Locus tag | DQM91_RS13535 | Protein ID | WP_000074048.1 |
| Coordinates | 2542545..2542811 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | W8TQT5 |
| Locus tag | DQM91_RS13540 | Protein ID | WP_000587616.1 |
| Coordinates | 2542811..2543068 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10648.23 Da Isoelectric Point: 10.1384
>T292443 WP_000074048.1 NZ_LS483365:c2542811-2542545 [Staphylococcus aureus subsp. aureus NCTC 8325]
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|