Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 2542545..2543068 | Replicon | chromosome |
Accession | NZ_LS483365 | ||
Organism | Staphylococcus aureus subsp. aureus NCTC 8325 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | X5DYX7 |
Locus tag | DQM91_RS13535 | Protein ID | WP_000074048.1 |
Coordinates | 2542545..2542811 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | W8TQT5 |
Locus tag | DQM91_RS13540 | Protein ID | WP_000587616.1 |
Coordinates | 2542811..2543068 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM91_RS13515 | 2537852..2539039 | - | 1188 | WP_000026194.1 | MFS transporter | - |
DQM91_RS13520 | 2539435..2540211 | - | 777 | WP_000072147.1 | iron export ABC transporter permease subunit FetB | - |
DQM91_RS13525 | 2540204..2540866 | - | 663 | WP_000923520.1 | ATP-binding cassette domain-containing protein | - |
DQM91_RS13530 | 2541114..2542190 | - | 1077 | WP_001076671.1 | M42 family metallopeptidase | - |
DQM91_RS13535 | 2542545..2542811 | - | 267 | WP_000074048.1 | Txe/YoeB family addiction module toxin | Toxin |
DQM91_RS13540 | 2542811..2543068 | - | 258 | WP_000587616.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DQM91_RS13550 | 2543427..2543882 | + | 456 | WP_000732082.1 | DUF1307 domain-containing protein | - |
DQM91_RS13555 | 2544050..2545627 | - | 1578 | WP_000143503.1 | FMN-binding glutamate synthase family protein | - |
DQM91_RS13560 | 2545822..2546571 | + | 750 | WP_000072443.1 | hypothetical protein | - |
DQM91_RS13565 | 2546795..2547988 | - | 1194 | WP_000675401.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10648.23 Da Isoelectric Point: 10.1384
>T292443 WP_000074048.1 NZ_LS483365:c2542811-2542545 [Staphylococcus aureus subsp. aureus NCTC 8325]
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLI
LSAWSHYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|