Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 2485692..2486209 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | T1YC79 |
| Locus tag | DQM91_RS13215 | Protein ID | WP_000113262.1 |
| Coordinates | 2485692..2485958 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | T1YB60 |
| Locus tag | DQM91_RS13220 | Protein ID | WP_000584499.1 |
| Coordinates | 2485958..2486209 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM91_RS13185 | 2481118..2481654 | - | 537 | WP_000169315.1 | GNAT family N-acetyltransferase | - |
| DQM91_RS13190 | 2481887..2482711 | - | 825 | WP_000572040.1 | formate/nitrite transporter family protein | - |
| DQM91_RS13195 | 2482928..2483110 | - | 183 | WP_000230294.1 | hypothetical protein | - |
| DQM91_RS13200 | 2483194..2483661 | - | 468 | WP_000153344.1 | SRPBCC domain-containing protein | - |
| DQM91_RS13205 | 2483847..2485397 | - | 1551 | WP_000727762.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
| DQM91_RS13210 | 2485586..2485657 | - | 72 | Protein_2442 | hypothetical protein | - |
| DQM91_RS13215 | 2485692..2485958 | - | 267 | WP_000113262.1 | Txe/YoeB family addiction module toxin | Toxin |
| DQM91_RS13220 | 2485958..2486209 | - | 252 | WP_000584499.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DQM91_RS13225 | 2486374..2486475 | - | 102 | WP_001791744.1 | hypothetical protein | - |
| DQM91_RS13230 | 2486482..2487081 | - | 600 | WP_000162813.1 | DsbA family protein | - |
| DQM91_RS13235 | 2487100..2487462 | - | 363 | WP_000819843.1 | DUF4467 domain-containing protein | - |
| DQM91_RS13240 | 2487717..2488967 | + | 1251 | WP_001012222.1 | FemA/FemB family glycyltransferase FmhA | - |
| DQM91_RS13245 | 2489064..2489795 | - | 732 | WP_000615461.1 | amino acid ABC transporter ATP-binding protein | - |
| DQM91_RS13250 | 2489792..2490511 | - | 720 | WP_000479576.1 | amino acid ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10437.95 Da Isoelectric Point: 9.9143
>T292441 WP_000113262.1 NZ_LS483365:c2485958-2485692 [Staphylococcus aureus subsp. aureus NCTC 8325]
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|