Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2220620..2220837 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DQM91_RS11790 | Protein ID | WP_001802298.1 |
| Coordinates | 2220733..2220837 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2220620..2220675 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM91_RS11770 | 2216814..2217479 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| DQM91_RS11775 | 2217631..2217951 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DQM91_RS11780 | 2217953..2218933 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| DQM91_RS11785 | 2219199..2220290 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2220620..2220675 | + | 56 | - | - | Antitoxin |
| DQM91_RS11790 | 2220733..2220837 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| DQM91_RS14985 | 2220998..2221481 | - | 484 | Protein_2176 | recombinase family protein | - |
| DQM91_RS11800 | 2221524..2222660 | - | 1137 | WP_000115562.1 | SAP domain-containing protein | - |
| DQM91_RS11805 | 2222949..2223041 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| DQM91_RS11810 | 2223746..2224603 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| DQM91_RS11815 | 2224671..2225453 | - | 783 | WP_000908177.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292440 WP_001802298.1 NZ_LS483365:c2220837-2220733 [Staphylococcus aureus subsp. aureus NCTC 8325]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT292440 NZ_LS483365:2220620-2220675 [Staphylococcus aureus subsp. aureus NCTC 8325]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|