Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2197572..2197835 | Replicon | chromosome |
| Accession | NZ_LS483350 | ||
| Organism | Staphylococcus aureus strain NCTC11940 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DQM92_RS11435 | Protein ID | WP_001802298.1 |
| Coordinates | 2197731..2197835 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2197572..2197736 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM92_RS11415 | 2193755..2194420 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| DQM92_RS11420 | 2194572..2194892 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DQM92_RS11425 | 2194894..2195874 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| DQM92_RS11430 | 2196140..2197231 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2197572..2197736 | + | 165 | - | - | Antitoxin |
| DQM92_RS11435 | 2197731..2197835 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| DQM92_RS14725 | 2197996..2198479 | - | 484 | Protein_2105 | recombinase family protein | - |
| DQM92_RS11445 | 2198522..2199394 | - | 873 | Protein_2106 | DNA-binding protein | - |
| DQM92_RS11450 | 2199446..2200618 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| DQM92_RS11460 | 2200721..2200990 | - | 270 | Protein_2108 | SAP domain-containing protein | - |
| DQM92_RS11465 | 2201279..2201371 | + | 93 | WP_001790138.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2199446..2200618 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292406 WP_001802298.1 NZ_LS483350:c2197835-2197731 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT292406 NZ_LS483350:2197572-2197736 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|