Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 183970..184483 Replicon chromosome
Accession NZ_LS483349
Organism Streptococcus mutans strain NCTC10449

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag DQM59_RS00975 Protein ID WP_002270995.1
Coordinates 183970..184224 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag DQM59_RS00980 Protein ID WP_002270994.1
Coordinates 184217..184483 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM59_RS00940 179846..180262 - 417 WP_002271002.1 conjugal transfer protein -
DQM59_RS00945 180264..180491 - 228 WP_002280083.1 hypothetical protein -
DQM59_RS00950 180508..181500 - 993 WP_002280082.1 conjugal transfer protein -
DQM59_RS00955 181510..182064 - 555 WP_002280081.1 hypothetical protein -
DQM59_RS00960 182061..182297 - 237 WP_002280080.1 hypothetical protein -
DQM59_RS00965 182317..182703 - 387 WP_002280079.1 hypothetical protein -
DQM59_RS00970 182681..183913 - 1233 WP_002280078.1 replication initiation factor domain-containing protein -
DQM59_RS00975 183970..184224 - 255 WP_002270995.1 Txe/YoeB family addiction module toxin Toxin
DQM59_RS00980 184217..184483 - 267 WP_002270994.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
DQM59_RS00985 184747..186405 - 1659 WP_002280077.1 transposase -
DQM59_RS00990 186412..186822 - 411 WP_002280076.1 DUF961 family protein -
DQM59_RS00995 186845..187159 - 315 WP_000406626.1 hypothetical protein -
DQM59_RS01005 187498..187734 - 237 WP_002280074.1 hypothetical protein -
DQM59_RS01010 187863..188141 - 279 WP_002280073.1 type II toxin-antitoxin system YafQ family toxin -
DQM59_RS01015 188142..188414 - 273 WP_002280072.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DQM59_RS01020 188566..189279 + 714 WP_002280071.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 8.3800

>T292393 WP_002270995.1 NZ_LS483349:c184224-183970 [Streptococcus mutans]
MFNFTEQAWKDYVSWQQEDKKILKRINRLIEDIKRNPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYLVEEDEIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10422.91 Da        Isoelectric Point: 4.6437

>AT292393 WP_002270994.1 NZ_LS483349:c184483-184217 [Streptococcus mutans]
MEAVVYSNFRNNLKNYMKKVNDEYEPLMVVNKNPDENIVVLSKENWDSIQETIRLMNNDYLSDKVLSGMEQVKQKKVVQR
QLLEVEDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References