Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2441071..2441255 | Replicon | chromosome |
| Accession | NC_020568 | ||
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | SAI8T7_RS12355 | Protein ID | WP_000482652.1 |
| Coordinates | 2441148..2441255 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2441071..2441131 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI8T7_RS12330 | 2436526..2436693 | - | 168 | Protein_2331 | hypothetical protein | - |
| SAI8T7_RS12340 | 2436924..2438657 | - | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
| SAI8T7_RS12345 | 2438682..2440445 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2441071..2441131 | + | 61 | - | - | Antitoxin |
| SAI8T7_RS12355 | 2441148..2441255 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAI8T7_RS12360 | 2441389..2441775 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| SAI8T7_RS12365 | 2442043..2443185 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| SAI8T7_RS12370 | 2443245..2443904 | + | 660 | WP_000831302.1 | hypothetical protein | - |
| SAI8T7_RS12375 | 2444086..2445297 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| SAI8T7_RS12380 | 2445420..2445893 | - | 474 | WP_015445934.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T29239 WP_000482652.1 NC_020568:c2441255-2441148 [Staphylococcus aureus subsp. aureus ST228]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29239 NC_020568:c2441255-2441148 [Staphylococcus aureus subsp. aureus ST228]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29239 NC_020568:2441071-2441131 [Staphylococcus aureus subsp. aureus ST228]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|