Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 2047901..2048208 | Replicon | chromosome |
Accession | NZ_LS483324 | ||
Organism | Staphylococcus aureus strain NCTC10344 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | DQL79_RS10530 | Protein ID | WP_072353918.1 |
Coordinates | 2048032..2048208 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2047901..2048040 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL79_RS10475 | 2043467..2043646 | + | 180 | WP_000669789.1 | hypothetical protein | - |
DQL79_RS10485 | 2043957..2044217 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL79_RS10490 | 2044270..2044620 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DQL79_RS10495 | 2045130..2045465 | - | 336 | Protein_1939 | SH3 domain-containing protein | - |
DQL79_RS10510 | 2046117..2046608 | - | 492 | WP_000920041.1 | staphylokinase | - |
DQL79_RS10515 | 2046799..2047554 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL79_RS10520 | 2047566..2047820 | - | 255 | WP_000611512.1 | phage holin | - |
DQL79_RS10525 | 2047872..2047979 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2047901..2048040 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2047901..2048040 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2047901..2048040 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2047901..2048040 | + | 140 | NuclAT_0 | - | Antitoxin |
DQL79_RS10530 | 2048032..2048208 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
DQL79_RS10535 | 2048351..2048725 | - | 375 | WP_000340977.1 | hypothetical protein | - |
DQL79_RS10540 | 2048781..2049068 | - | 288 | WP_001262620.1 | hypothetical protein | - |
DQL79_RS10545 | 2049114..2049266 | - | 153 | WP_001000058.1 | hypothetical protein | - |
DQL79_RS10550 | 2049259..2053041 | - | 3783 | WP_001836550.1 | phage protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2044270..2112802 | 68532 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T292364 WP_072353918.1 NZ_LS483324:c2048208-2048032 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT292364 NZ_LS483324:2047901-2048040 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|