Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2337170..2337433 | Replicon | chromosome |
| Accession | NZ_LS483319 | ||
| Organism | Staphylococcus aureus strain NCTC13140 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DQL82_RS12445 | Protein ID | WP_001802298.1 |
| Coordinates | 2337329..2337433 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2337170..2337334 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL82_RS12425 | 2333353..2334018 | - | 666 | WP_045177733.1 | SDR family oxidoreductase | - |
| DQL82_RS12430 | 2334170..2334490 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DQL82_RS12435 | 2334492..2335472 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| DQL82_RS12440 | 2335738..2336829 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2337170..2337334 | + | 165 | - | - | Antitoxin |
| DQL82_RS12445 | 2337329..2337433 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| DQL82_RS15670 | 2337594..2338077 | - | 484 | Protein_2304 | recombinase family protein | - |
| DQL82_RS12455 | 2338120..2339256 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| DQL82_RS12460 | 2339545..2339637 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| DQL82_RS12465 | 2340342..2341199 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| DQL82_RS12470 | 2341267..2342049 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292353 WP_001802298.1 NZ_LS483319:c2337433-2337329 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT292353 NZ_LS483319:2337170-2337334 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|