Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2161361..2161660 | Replicon | chromosome |
Accession | NZ_LS483319 | ||
Organism | Staphylococcus aureus strain NCTC13140 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DQL82_RS11420 | Protein ID | WP_011447039.1 |
Coordinates | 2161484..2161660 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2161361..2161416 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL82_RS11375 | 2156696..2156956 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL82_RS11380 | 2157009..2157359 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DQL82_RS11385 | 2158040..2158489 | + | 450 | WP_000727652.1 | chemotaxis-inhibiting protein CHIPS | - |
DQL82_RS11390 | 2158584..2158919 | - | 336 | Protein_2102 | SH3 domain-containing protein | - |
DQL82_RS11400 | 2159569..2160060 | - | 492 | WP_000919350.1 | staphylokinase | - |
DQL82_RS11405 | 2160251..2161006 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL82_RS11410 | 2161018..2161272 | - | 255 | WP_000611512.1 | phage holin | - |
DQL82_RS11415 | 2161324..2161431 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2161353..2161492 | + | 140 | NuclAT_0 | - | - |
- | 2161353..2161492 | + | 140 | NuclAT_0 | - | - |
- | 2161353..2161492 | + | 140 | NuclAT_0 | - | - |
- | 2161353..2161492 | + | 140 | NuclAT_0 | - | - |
- | 2161361..2161416 | + | 56 | - | - | Antitoxin |
DQL82_RS11420 | 2161484..2161660 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DQL82_RS11425 | 2161810..2162106 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DQL82_RS11430 | 2162164..2162451 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DQL82_RS11435 | 2162498..2162650 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DQL82_RS11440 | 2162640..2166425 | - | 3786 | WP_000582158.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2157009..2214011 | 57002 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292346 WP_011447039.1 NZ_LS483319:c2161660-2161484 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292346 NZ_LS483319:2161361-2161416 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|