Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1231143..1231325 | Replicon | chromosome |
| Accession | NZ_LS483319 | ||
| Organism | Staphylococcus aureus strain NCTC13140 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL82_RS06540 | Protein ID | WP_001801861.1 |
| Coordinates | 1231230..1231325 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1231143..1231202 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL82_RS06525 | 1230281..1230658 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| DQL82_RS06530 | 1230852..1231028 | + | 177 | Protein_1177 | transposase | - |
| DQL82_RS06535 | 1231006..1231107 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 1231143..1231202 | + | 60 | - | - | Antitoxin |
| DQL82_RS06540 | 1231230..1231325 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| DQL82_RS06550 | 1231528..1231671 | + | 144 | WP_001549059.1 | transposase | - |
| DQL82_RS06560 | 1232275..1232658 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| DQL82_RS06565 | 1232669..1232845 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| DQL82_RS06570 | 1232847..1233032 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| DQL82_RS06575 | 1233146..1233787 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL82_RS06580 | 1234005..1234556 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| DQL82_RS06585 | 1234654..1234998 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| DQL82_RS06590 | 1235039..1235665 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 1196720..1257351 | 60631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292345 WP_001801861.1 NZ_LS483319:c1231325-1231230 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT292345 NZ_LS483319:1231143-1231202 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|