Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1231143..1231325 Replicon chromosome
Accession NZ_LS483319
Organism Staphylococcus aureus strain NCTC13140

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL82_RS06540 Protein ID WP_001801861.1
Coordinates 1231230..1231325 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1231143..1231202 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL82_RS06525 1230281..1230658 + 378 WP_001037045.1 DUF1433 domain-containing protein -
DQL82_RS06530 1230852..1231028 + 177 Protein_1177 transposase -
DQL82_RS06535 1231006..1231107 - 102 WP_001791893.1 hypothetical protein -
- 1231143..1231202 + 60 - - Antitoxin
DQL82_RS06540 1231230..1231325 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
DQL82_RS06550 1231528..1231671 + 144 WP_001549059.1 transposase -
DQL82_RS06560 1232275..1232658 + 384 WP_000070811.1 hypothetical protein -
DQL82_RS06565 1232669..1232845 + 177 WP_000375476.1 hypothetical protein -
DQL82_RS06570 1232847..1233032 + 186 WP_000809857.1 hypothetical protein -
DQL82_RS06575 1233146..1233787 + 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQL82_RS06580 1234005..1234556 - 552 WP_000414205.1 hypothetical protein -
DQL82_RS06585 1234654..1234998 - 345 WP_000627551.1 DUF3969 family protein -
DQL82_RS06590 1235039..1235665 - 627 WP_000669046.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - hlgA / lukD 1196720..1257351 60631


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292345 WP_001801861.1 NZ_LS483319:c1231325-1231230 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292345 NZ_LS483319:1231143-1231202 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References