Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 272547..273060 Replicon chromosome
Accession NZ_LS483318
Organism Streptococcus dysgalactiae subsp. equisimilis strain NCTC5370

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag DQM44_RS01500 Protein ID WP_022554217.1
Coordinates 272547..272801 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag DQM44_RS01505 Protein ID WP_003053797.1
Coordinates 272794..273060 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM44_RS01470 268789..269199 - 411 WP_003053802.1 conjugal transfer protein -
DQM44_RS01475 269202..269426 - 225 WP_003053785.1 hypothetical protein -
DQM44_RS01480 269430..270440 - 1011 WP_022554213.1 conjugal transfer protein -
DQM44_RS01485 270452..270988 - 537 Protein_240 hypothetical protein -
DQM44_RS01490 271015..271245 - 231 WP_003053793.1 hypothetical protein -
DQM44_RS01495 271265..272491 - 1227 WP_022554216.1 replication initiation factor domain-containing protein -
DQM44_RS01500 272547..272801 - 255 WP_022554217.1 Txe/YoeB family addiction module toxin Toxin
DQM44_RS01505 272794..273060 - 267 WP_003053797.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DQM44_RS01510 273325..275011 - 1687 Protein_245 cell division protein FtsK -
DQM44_RS01515 275028..275489 - 462 WP_003056467.1 hypothetical protein -
DQM44_RS01520 275508..275804 - 297 WP_003056470.1 hypothetical protein -
DQM44_RS01525 275847..276089 - 243 Protein_248 hypothetical protein -
DQM44_RS01530 276621..276962 + 342 WP_111711548.1 helix-turn-helix domain-containing protein -
DQM44_RS01535 277166..277471 + 306 WP_014612001.1 hypothetical protein -
DQM44_RS01540 277506..277865 - 360 WP_003053656.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 248633..292188 43555


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(3-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10457.80 Da        Isoelectric Point: 8.0295

>T292342 WP_022554217.1 NZ_LS483318:c272801-272547 [Streptococcus dysgalactiae subsp. equisimilis]
MFNCTEEAWEDYTSWQREDKKILKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10402.81 Da        Isoelectric Point: 4.5216

>AT292342 WP_003053797.1 NZ_LS483318:c273060-272794 [Streptococcus dysgalactiae subsp. equisimilis]
MEAVVYSNFRNNLKDYMKKVNDEYEPLMVVNKNPEENIVVLSKDNWDSIQETIRIMNNEYLSDKVLSGLEQVKQKKVTQH
QLLEVEDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References