Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2504383..2504567 | Replicon | chromosome |
Accession | NZ_LS483317 | ||
Organism | Staphylococcus aureus strain NCTC5663 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DQL75_RS12930 | Protein ID | WP_000482647.1 |
Coordinates | 2504460..2504567 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2504383..2504443 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL75_RS12905 | 2499836..2500003 | - | 168 | WP_001789205.1 | hypothetical protein | - |
DQL75_RS12915 | 2500234..2501967 | - | 1734 | WP_111762661.1 | ABC transporter ATP-binding protein/permease | - |
DQL75_RS12920 | 2501992..2503756 | - | 1765 | Protein_2395 | ABC transporter ATP-binding protein | - |
- | 2504383..2504443 | + | 61 | - | - | Antitoxin |
DQL75_RS12930 | 2504460..2504567 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DQL75_RS12935 | 2504701..2505087 | - | 387 | WP_000779353.1 | flippase GtxA | - |
DQL75_RS12940 | 2505355..2506497 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
DQL75_RS12945 | 2506557..2507216 | + | 660 | WP_000831304.1 | hypothetical protein | - |
DQL75_RS12950 | 2507399..2508610 | + | 1212 | WP_001191924.1 | multidrug effflux MFS transporter | - |
DQL75_RS12955 | 2508733..2509206 | - | 474 | WP_111762662.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T292341 WP_000482647.1 NZ_LS483317:c2504567-2504460 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT292341 NZ_LS483317:2504383-2504443 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|