Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2213961..2214224 | Replicon | chromosome |
Accession | NZ_LS483317 | ||
Organism | Staphylococcus aureus strain NCTC5663 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DQL75_RS11380 | Protein ID | WP_001802298.1 |
Coordinates | 2214120..2214224 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2213961..2214125 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL75_RS11360 | 2210077..2210742 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
DQL75_RS11365 | 2210894..2211214 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DQL75_RS11370 | 2211216..2212196 | + | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
DQL75_RS11375 | 2212462..2213553 | + | 1092 | WP_111762538.1 | transcriptional regulator | - |
- | 2213961..2214125 | + | 165 | - | - | Antitoxin |
DQL75_RS11380 | 2214120..2214224 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DQL75_RS11385 | 2214385..2214885 | - | 501 | Protein_2110 | recombinase family protein | - |
DQL75_RS11390 | 2214928..2216064 | - | 1137 | WP_111762539.1 | SAP domain-containing protein | - |
DQL75_RS11395 | 2217107..2217964 | - | 858 | WP_111762540.1 | Cof-type HAD-IIB family hydrolase | - |
DQL75_RS11400 | 2218031..2218813 | - | 783 | WP_111762541.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292338 WP_001802298.1 NZ_LS483317:c2214224-2214120 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT292338 NZ_LS483317:2213961-2214125 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|