Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1900961..1901141 | Replicon | chromosome |
| Accession | NZ_LS483317 | ||
| Organism | Staphylococcus aureus strain NCTC5663 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL75_RS09580 | Protein ID | WP_001801861.1 |
| Coordinates | 1900961..1901056 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1901084..1901141 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL75_RS09540 | 1896331..1896957 | + | 627 | WP_111762417.1 | hypothetical protein | - |
| DQL75_RS09545 | 1896984..1897727 | + | 744 | WP_111762418.1 | exotoxin | - |
| DQL75_RS09550 | 1897754..1898506 | + | 753 | WP_111762419.1 | staphylococcal enterotoxin type 27 | - |
| DQL75_RS09555 | 1898638..1899195 | - | 558 | WP_111762420.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL75_RS09560 | 1899379..1899564 | - | 186 | WP_111762421.1 | hypothetical protein | - |
| DQL75_RS09565 | 1899566..1899742 | - | 177 | WP_000375478.1 | hypothetical protein | - |
| DQL75_RS09570 | 1899762..1900132 | - | 371 | Protein_1809 | hypothetical protein | - |
| DQL75_RS09575 | 1900341..1900538 | - | 198 | Protein_1810 | transposase | - |
| DQL75_RS09580 | 1900961..1901056 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1901084..1901141 | - | 58 | - | - | Antitoxin |
| DQL75_RS09590 | 1901984..1902427 | - | 444 | WP_111762422.1 | DUF1433 domain-containing protein | - |
| DQL75_RS09595 | 1902427..1902870 | - | 444 | WP_111762423.1 | DUF1433 domain-containing protein | - |
| DQL75_RS09600 | 1903399..1905822 | + | 2424 | WP_111762424.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292334 WP_001801861.1 NZ_LS483317:1900961-1901056 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT292334 NZ_LS483317:c1901141-1901084 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|