Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1900961..1901141 Replicon chromosome
Accession NZ_LS483317
Organism Staphylococcus aureus strain NCTC5663

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL75_RS09580 Protein ID WP_001801861.1
Coordinates 1900961..1901056 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1901084..1901141 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL75_RS09540 1896331..1896957 + 627 WP_111762417.1 hypothetical protein -
DQL75_RS09545 1896984..1897727 + 744 WP_111762418.1 exotoxin -
DQL75_RS09550 1897754..1898506 + 753 WP_111762419.1 staphylococcal enterotoxin type 27 -
DQL75_RS09555 1898638..1899195 - 558 WP_111762420.1 ImmA/IrrE family metallo-endopeptidase -
DQL75_RS09560 1899379..1899564 - 186 WP_111762421.1 hypothetical protein -
DQL75_RS09565 1899566..1899742 - 177 WP_000375478.1 hypothetical protein -
DQL75_RS09570 1899762..1900132 - 371 Protein_1809 hypothetical protein -
DQL75_RS09575 1900341..1900538 - 198 Protein_1810 transposase -
DQL75_RS09580 1900961..1901056 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1901084..1901141 - 58 - - Antitoxin
DQL75_RS09590 1901984..1902427 - 444 WP_111762422.1 DUF1433 domain-containing protein -
DQL75_RS09595 1902427..1902870 - 444 WP_111762423.1 DUF1433 domain-containing protein -
DQL75_RS09600 1903399..1905822 + 2424 WP_111762424.1 polysaccharide lyase 8 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292334 WP_001801861.1 NZ_LS483317:1900961-1901056 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT292334 NZ_LS483317:c1901141-1901084 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References