Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 368372..368679 | Replicon | chromosome |
Accession | NZ_LS483317 | ||
Organism | Staphylococcus aureus strain NCTC5663 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
Locus tag | DQL75_RS01780 | Protein ID | WP_072357969.1 |
Coordinates | 368372..368548 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 368540..368679 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL75_RS01760 | 363607..367392 | + | 3786 | WP_111761862.1 | hypothetical protein | - |
DQL75_RS01765 | 367382..367534 | + | 153 | WP_031867842.1 | hypothetical protein | - |
DQL75_RS01770 | 367581..367868 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DQL75_RS01775 | 367926..368222 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DQL75_RS01780 | 368372..368548 | + | 177 | WP_072357969.1 | putative holin-like toxin | Toxin |
- | 368540..368679 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 368540..368679 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 368540..368679 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 368540..368679 | - | 140 | NuclAT_0 | - | Antitoxin |
DQL75_RS01785 | 368601..368708 | - | 108 | WP_047551145.1 | hypothetical protein | - |
DQL75_RS01790 | 368760..369014 | + | 255 | WP_045178738.1 | phage holin | - |
DQL75_RS01795 | 369026..369781 | + | 756 | WP_111761863.1 | CHAP domain-containing protein | - |
DQL75_RS01800 | 370220..371155 | + | 936 | WP_111761864.1 | bi-component leukocidin LukPQ subunit P | - |
DQL75_RS01805 | 371157..372137 | + | 981 | WP_086037611.1 | bi-component leukocidin LukPQ subunit Q | - |
DQL75_RS01810 | 372578..372922 | + | 345 | WP_106096712.1 | complement inhibitor SCIN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 330594..372922 | 42328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T292332 WP_072357969.1 NZ_LS483317:368372-368548 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT292332 NZ_LS483317:c368679-368540 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|