Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 368372..368710 | Replicon | chromosome |
| Accession | NZ_LS483317 | ||
| Organism | Staphylococcus aureus strain NCTC5663 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
| Locus tag | DQL75_RS01780 | Protein ID | WP_072357969.1 |
| Coordinates | 368372..368548 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 368536..368710 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL75_RS01760 | 363607..367392 | + | 3786 | WP_111761862.1 | hypothetical protein | - |
| DQL75_RS01765 | 367382..367534 | + | 153 | WP_031867842.1 | hypothetical protein | - |
| DQL75_RS01770 | 367581..367868 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DQL75_RS01775 | 367926..368222 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DQL75_RS01780 | 368372..368548 | + | 177 | WP_072357969.1 | putative holin-like toxin | Toxin |
| - | 368536..368710 | - | 175 | - | - | Antitoxin |
| DQL75_RS01790 | 368760..369014 | + | 255 | WP_045178738.1 | phage holin | - |
| DQL75_RS01795 | 369026..369781 | + | 756 | WP_111761863.1 | CHAP domain-containing protein | - |
| DQL75_RS01800 | 370220..371155 | + | 936 | WP_111761864.1 | bi-component leukocidin LukPQ subunit P | - |
| DQL75_RS01805 | 371157..372137 | + | 981 | WP_086037611.1 | bi-component leukocidin LukPQ subunit Q | - |
| DQL75_RS01810 | 372578..372922 | + | 345 | WP_106096712.1 | complement inhibitor SCIN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 330594..372922 | 42328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T292330 WP_072357969.1 NZ_LS483317:368372-368548 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT292330 NZ_LS483317:c368710-368536 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACACGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|