Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 345054..345468 Replicon chromosome
Accession NZ_LS483317
Organism Staphylococcus aureus strain NCTC5663

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DQL75_RS01630 Protein ID WP_110166336.1
Coordinates 345054..345305 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DQL75_RS14485 Protein ID WP_000028424.1
Coordinates 345295..345468 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL75_RS01575 340610..340966 + 357 WP_031911827.1 hypothetical protein -
DQL75_RS01580 340963..342204 + 1242 WP_111761858.1 AAA family ATPase -
DQL75_RS01585 342201..342416 + 216 WP_015978374.1 hypothetical protein -
DQL75_RS01590 342420..342641 + 222 WP_001123688.1 DUF3269 family protein -
DQL75_RS01595 342652..343056 + 405 WP_000049784.1 DUF1064 domain-containing protein -
DQL75_RS01600 343061..343246 + 186 WP_001187242.1 DUF3113 family protein -
DQL75_RS14560 343289..343576 + 288 WP_197709053.1 hypothetical protein -
DQL75_RS14565 343573..343863 + 291 WP_197709052.1 hypothetical protein -
DQL75_RS01610 343863..344117 + 255 WP_031867833.1 DUF3310 domain-containing protein -
DQL75_RS01615 344117..344365 + 249 WP_078100129.1 phi PVL orf 51-like protein -
DQL75_RS01620 344379..344786 + 408 WP_031867835.1 hypothetical protein -
DQL75_RS01625 344786..345061 + 276 WP_111761859.1 hypothetical protein -
DQL75_RS01630 345054..345305 + 252 WP_110166336.1 DUF1024 family protein Toxin
DQL75_RS14485 345295..345468 + 174 WP_000028424.1 hypothetical protein Antitoxin
DQL75_RS01635 345469..345750 + 282 WP_000454994.1 hypothetical protein -
DQL75_RS14490 345751..345912 + 162 WP_000889683.1 hypothetical protein -
DQL75_RS01640 345927..346460 + 534 WP_025920701.1 dUTP diphosphatase -
DQL75_RS01645 346497..346703 + 207 WP_033859700.1 DUF1381 domain-containing protein -
DQL75_RS01650 346700..346849 + 150 WP_000595265.1 transcriptional activator RinB -
DQL75_RS01655 346849..347049 + 201 WP_111761860.1 DUF1514 family protein -
DQL75_RS01665 347072..347533 + 462 WP_086037675.1 hypothetical protein -
DQL75_RS01670 347648..348100 + 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
DQL75_RS01675 348116..348460 + 345 WP_000817289.1 HNH endonuclease -
DQL75_RS01680 348589..349056 + 468 WP_000919026.1 phage terminase small subunit P27 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - hlgA / lukD 330594..372922 42328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9445.35 Da        Isoelectric Point: 3.9476

>T292329 WP_110166336.1 NZ_LS483317:345054-345305 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGMTNAIQHSVREGIELDEAVGIMAGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT292329 WP_000028424.1 NZ_LS483317:345295-345468 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References