Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2256348..2256565 | Replicon | chromosome |
Accession | NZ_LS483316 | ||
Organism | Staphylococcus aureus strain NCTC13395 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DQL73_RS11860 | Protein ID | WP_001802298.1 |
Coordinates | 2256461..2256565 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2256348..2256403 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL73_RS11840 | 2252485..2253150 | - | 666 | WP_045177733.1 | SDR family oxidoreductase | - |
DQL73_RS11845 | 2253302..2253622 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DQL73_RS11850 | 2253624..2254604 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
DQL73_RS11855 | 2254870..2255961 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2256348..2256403 | + | 56 | - | - | Antitoxin |
DQL73_RS11860 | 2256461..2256565 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DQL73_RS15070 | 2256726..2257209 | - | 484 | Protein_2183 | recombinase family protein | - |
DQL73_RS11870 | 2257252..2258388 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
DQL73_RS11875 | 2258677..2258769 | + | 93 | WP_001790138.1 | hypothetical protein | - |
DQL73_RS11880 | 2259474..2260331 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
DQL73_RS11885 | 2260399..2261181 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292325 WP_001802298.1 NZ_LS483316:c2256565-2256461 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT292325 NZ_LS483316:2256348-2256403 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|