Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2078958..2079257 | Replicon | chromosome |
| Accession | NZ_LS483316 | ||
| Organism | Staphylococcus aureus strain NCTC13395 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | DQL73_RS10810 | Protein ID | WP_072353918.1 |
| Coordinates | 2079081..2079257 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2078958..2079013 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL73_RS10750 | 2074517..2074696 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| DQL73_RS10760 | 2075007..2075267 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DQL73_RS10765 | 2075320..2075670 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DQL73_RS10770 | 2076180..2076515 | - | 336 | Protein_1979 | SH3 domain-containing protein | - |
| DQL73_RS10790 | 2077166..2077657 | - | 492 | WP_000920038.1 | staphylokinase | - |
| DQL73_RS10795 | 2077848..2078603 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DQL73_RS10800 | 2078615..2078869 | - | 255 | WP_000611512.1 | phage holin | - |
| DQL73_RS10805 | 2078921..2079028 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2078950..2079089 | + | 140 | NuclAT_0 | - | - |
| - | 2078950..2079089 | + | 140 | NuclAT_0 | - | - |
| - | 2078950..2079089 | + | 140 | NuclAT_0 | - | - |
| - | 2078950..2079089 | + | 140 | NuclAT_0 | - | - |
| - | 2078958..2079013 | + | 56 | - | - | Antitoxin |
| DQL73_RS10810 | 2079081..2079257 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
| DQL73_RS10815 | 2079400..2079774 | - | 375 | WP_111761281.1 | hypothetical protein | - |
| DQL73_RS10820 | 2079830..2080117 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| DQL73_RS10825 | 2080163..2080315 | - | 153 | WP_001000058.1 | hypothetical protein | - |
| DQL73_RS10830 | 2080308..2084090 | - | 3783 | WP_031901052.1 | phage minor structural protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / hlb / groEL | 2075320..2131305 | 55985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T292319 WP_072353918.1 NZ_LS483316:c2079257-2079081 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292319 NZ_LS483316:2078958-2079013 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|