Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2252715..2252931 | Replicon | chromosome |
| Accession | NZ_LS483311 | ||
| Organism | Staphylococcus aureus strain NCTC6136 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DQL83_RS11910 | Protein ID | WP_001802298.1 |
| Coordinates | 2252827..2252931 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2252715..2252770 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL83_RS11890 | 2248909..2249574 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| DQL83_RS11895 | 2249726..2250046 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DQL83_RS11900 | 2250048..2251028 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| DQL83_RS11905 | 2251294..2252385 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| - | 2252715..2252770 | + | 56 | - | - | Antitoxin |
| DQL83_RS11910 | 2252827..2252931 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| DQL83_RS15115 | 2253448..2253618 | + | 171 | WP_001792292.1 | transposase | - |
| DQL83_RS11920 | 2253611..2253769 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| DQL83_RS11930 | 2254427..2255284 | - | 858 | WP_000370930.1 | Cof-type HAD-IIB family hydrolase | - |
| DQL83_RS11935 | 2255352..2256134 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292297 WP_001802298.1 NZ_LS483311:c2252931-2252827 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT292297 NZ_LS483311:2252715-2252770 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|