Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2076419..2076718 | Replicon | chromosome |
| Accession | NZ_LS483311 | ||
| Organism | Staphylococcus aureus strain NCTC6136 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DQL83_RS10870 | Protein ID | WP_011447039.1 |
| Coordinates | 2076542..2076718 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2076419..2076474 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL83_RS10825 | 2071750..2072010 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DQL83_RS10830 | 2072063..2072413 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DQL83_RS10835 | 2073098..2073547 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DQL83_RS10840 | 2073642..2073977 | - | 336 | Protein_2005 | SH3 domain-containing protein | - |
| DQL83_RS10850 | 2074627..2075118 | - | 492 | WP_000920037.1 | staphylokinase | - |
| DQL83_RS10855 | 2075309..2076064 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DQL83_RS10860 | 2076076..2076330 | - | 255 | WP_000611512.1 | phage holin | - |
| DQL83_RS10865 | 2076382..2076489 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2076411..2076550 | + | 140 | NuclAT_0 | - | - |
| - | 2076411..2076550 | + | 140 | NuclAT_0 | - | - |
| - | 2076411..2076550 | + | 140 | NuclAT_0 | - | - |
| - | 2076411..2076550 | + | 140 | NuclAT_0 | - | - |
| - | 2076419..2076474 | + | 56 | - | - | Antitoxin |
| DQL83_RS10870 | 2076542..2076718 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DQL83_RS10875 | 2076868..2077164 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DQL83_RS10880 | 2077222..2077509 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| DQL83_RS10885 | 2077556..2077708 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| DQL83_RS10890 | 2077698..2081483 | - | 3786 | WP_000582186.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2072063..2128740 | 56677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292293 WP_011447039.1 NZ_LS483311:c2076718-2076542 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292293 NZ_LS483311:2076419-2076474 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|