Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1928555..1928735 | Replicon | chromosome |
| Accession | NZ_LS483311 | ||
| Organism | Staphylococcus aureus strain NCTC6136 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL83_RS09895 | Protein ID | WP_001801861.1 |
| Coordinates | 1928555..1928650 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1928678..1928735 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL83_RS09865 | 1924611..1925237 | + | 627 | WP_000669028.1 | hypothetical protein | - |
| DQL83_RS09870 | 1925323..1926006 | + | 684 | WP_000957233.1 | enterotoxin I | - |
| DQL83_RS09875 | 1926033..1926785 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
| DQL83_RS09880 | 1926917..1927473 | - | 557 | Protein_1861 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL83_RS09885 | 1927657..1928103 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
| DQL83_RS09895 | 1928555..1928650 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1928678..1928735 | - | 58 | - | - | Antitoxin |
| DQL83_RS09900 | 1929301..1930996 | - | 1696 | Protein_1864 | hypothetical protein | - |
| DQL83_RS09905 | 1930974..1931827 | - | 854 | Protein_1865 | DNA adenine methylase | - |
| DQL83_RS09910 | 1931866..1933131 | - | 1266 | WP_031796962.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selq / selk | 1922053..1950016 | 27963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292290 WP_001801861.1 NZ_LS483311:1928555-1928650 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT292290 NZ_LS483311:c1928735-1928678 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|