Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1834743..1834923 | Replicon | chromosome |
| Accession | NC_020568 | ||
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAI8T7_RS14805 | Protein ID | WP_001801861.1 |
| Coordinates | 1834743..1834838 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1834866..1834923 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI8T7_RS08865 | 1829906..1830556 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| SAI8T7_RS08870 | 1830637..1831632 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| SAI8T7_RS08875 | 1831707..1832333 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| SAI8T7_RS08880 | 1832374..1832715 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| SAI8T7_RS08885 | 1832816..1833388 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| SAI8T7_RS14450 | 1833586..1834598 | - | 1013 | Protein_1703 | IS3 family transposase | - |
| SAI8T7_RS14805 | 1834743..1834838 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1834866..1834923 | - | 58 | - | - | Antitoxin |
| SAI8T7_RS08905 | 1834961..1835062 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| SAI8T7_RS14810 | 1835040..1835201 | - | 162 | Protein_1706 | transposase | - |
| SAI8T7_RS08910 | 1835192..1835686 | - | 495 | Protein_1707 | transposase | - |
| SAI8T7_RS08915 | 1836138..1837366 | - | 1229 | Protein_1708 | restriction endonuclease subunit S | - |
| SAI8T7_RS08920 | 1837359..1838915 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| SAI8T7_RS08925 | 1839079..1839213 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1810601..1861745 | 51144 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29228 WP_001801861.1 NC_020568:1834743-1834838 [Staphylococcus aureus subsp. aureus ST228]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29228 NC_020568:1834743-1834838 [Staphylococcus aureus subsp. aureus ST228]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT29228 NC_020568:c1834923-1834866 [Staphylococcus aureus subsp. aureus ST228]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|