Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1931772..1932079 | Replicon | chromosome |
Accession | NZ_LS483310 | ||
Organism | Staphylococcus aureus strain NCTC9752 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | DQL84_RS09925 | Protein ID | WP_072353918.1 |
Coordinates | 1931903..1932079 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1931772..1931911 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL84_RS09870 | 1927338..1927517 | + | 180 | WP_000669789.1 | hypothetical protein | - |
DQL84_RS09880 | 1927828..1928088 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL84_RS09885 | 1928141..1928491 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DQL84_RS09890 | 1929001..1929336 | - | 336 | Protein_1826 | SH3 domain-containing protein | - |
DQL84_RS09905 | 1929988..1930479 | - | 492 | WP_000920041.1 | staphylokinase | - |
DQL84_RS09910 | 1930670..1931425 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL84_RS09915 | 1931437..1931691 | - | 255 | WP_000611512.1 | phage holin | - |
DQL84_RS09920 | 1931743..1931850 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1931772..1931911 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1931772..1931911 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1931772..1931911 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1931772..1931911 | + | 140 | NuclAT_0 | - | Antitoxin |
DQL84_RS09925 | 1931903..1932079 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
DQL84_RS09930 | 1932222..1932596 | - | 375 | WP_000340977.1 | hypothetical protein | - |
DQL84_RS09935 | 1932652..1932939 | - | 288 | WP_001262620.1 | hypothetical protein | - |
DQL84_RS09940 | 1932985..1933137 | - | 153 | WP_001000058.1 | hypothetical protein | - |
DQL84_RS09945 | 1933130..1936912 | - | 3783 | WP_001836550.1 | phage protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1928141..1996468 | 68327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T292277 WP_072353918.1 NZ_LS483310:c1932079-1931903 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT292277 NZ_LS483310:1931772-1931911 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|