Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2135842..2136141 | Replicon | chromosome |
Accession | NZ_LS483309 | ||
Organism | Staphylococcus aureus strain NCTC9944 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DQL96_RS11135 | Protein ID | WP_011447039.1 |
Coordinates | 2135965..2136141 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2135842..2135897 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL96_RS11090 | 2131669..2131848 | + | 180 | Protein_2046 | sphingomyelin phosphodiesterase | - |
DQL96_RS11095 | 2132238..2132417 | + | 180 | WP_000669789.1 | hypothetical protein | - |
DQL96_RS11105 | 2132728..2132988 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL96_RS11110 | 2133041..2133391 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DQL96_RS11115 | 2134050..2134541 | - | 492 | WP_000919350.1 | staphylokinase | - |
DQL96_RS11120 | 2134732..2135487 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL96_RS11125 | 2135499..2135753 | - | 255 | WP_000611512.1 | phage holin | - |
DQL96_RS11130 | 2135805..2135912 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2135834..2135973 | + | 140 | NuclAT_0 | - | - |
- | 2135834..2135973 | + | 140 | NuclAT_0 | - | - |
- | 2135834..2135973 | + | 140 | NuclAT_0 | - | - |
- | 2135834..2135973 | + | 140 | NuclAT_0 | - | - |
- | 2135842..2135897 | + | 56 | - | - | Antitoxin |
DQL96_RS11135 | 2135965..2136141 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DQL96_RS11140 | 2136291..2136587 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DQL96_RS11145 | 2136645..2136932 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DQL96_RS11150 | 2136979..2137131 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DQL96_RS11155 | 2137121..2140906 | - | 3786 | WP_053015728.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2133041..2192330 | 59289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292263 WP_011447039.1 NZ_LS483309:c2136141-2135965 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT292263 NZ_LS483309:2135842-2135897 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|