Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1931207..1931389 Replicon chromosome
Accession NZ_LS483309
Organism Staphylococcus aureus strain NCTC9944

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL96_RS09725 Protein ID WP_001801861.1
Coordinates 1931207..1931302 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1931330..1931389 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL96_RS09675 1926868..1927493 + 626 Protein_1818 hypothetical protein -
DQL96_RS09680 1927534..1927878 + 345 WP_000627551.1 DUF3969 family protein -
DQL96_RS09685 1927976..1928527 + 552 Protein_1820 hypothetical protein -
DQL96_RS09690 1928745..1929386 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQL96_RS09695 1929500..1929685 - 186 WP_000809857.1 hypothetical protein -
DQL96_RS09700 1929687..1929863 - 177 WP_000375476.1 hypothetical protein -
DQL96_RS09705 1929874..1930257 - 384 WP_000070811.1 hypothetical protein -
DQL96_RS09715 1930861..1931004 - 144 WP_001549059.1 transposase -
DQL96_RS09725 1931207..1931302 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1931330..1931389 - 60 - - Antitoxin
DQL96_RS09730 1931425..1931526 + 102 WP_001791893.1 hypothetical protein -
DQL96_RS09735 1931504..1931680 - 177 Protein_1828 transposase -
DQL96_RS09740 1931874..1932251 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1924308..2009825 85517


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292260 WP_001801861.1 NZ_LS483309:1931207-1931302 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292260 NZ_LS483309:c1931389-1931330 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References