Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1931207..1931389 | Replicon | chromosome |
| Accession | NZ_LS483309 | ||
| Organism | Staphylococcus aureus strain NCTC9944 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL96_RS09725 | Protein ID | WP_001801861.1 |
| Coordinates | 1931207..1931302 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1931330..1931389 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL96_RS09675 | 1926868..1927493 | + | 626 | Protein_1818 | hypothetical protein | - |
| DQL96_RS09680 | 1927534..1927878 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| DQL96_RS09685 | 1927976..1928527 | + | 552 | Protein_1820 | hypothetical protein | - |
| DQL96_RS09690 | 1928745..1929386 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL96_RS09695 | 1929500..1929685 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| DQL96_RS09700 | 1929687..1929863 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| DQL96_RS09705 | 1929874..1930257 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| DQL96_RS09715 | 1930861..1931004 | - | 144 | WP_001549059.1 | transposase | - |
| DQL96_RS09725 | 1931207..1931302 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1931330..1931389 | - | 60 | - | - | Antitoxin |
| DQL96_RS09730 | 1931425..1931526 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| DQL96_RS09735 | 1931504..1931680 | - | 177 | Protein_1828 | transposase | - |
| DQL96_RS09740 | 1931874..1932251 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1924308..2009825 | 85517 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292260 WP_001801861.1 NZ_LS483309:1931207-1931302 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT292260 NZ_LS483309:c1931389-1931330 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|