Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2164727..2164943 | Replicon | chromosome |
Accession | NZ_LS483308 | ||
Organism | Staphylococcus aureus strain NCTC13137 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | DQL85_RS11215 | Protein ID | WP_075583739.1 |
Coordinates | 2164839..2164943 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2164727..2164782 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL85_RS11195 | 2160861..2161526 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
DQL85_RS11200 | 2161678..2161998 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DQL85_RS11205 | 2162000..2162977 | + | 978 | WP_006190804.1 | CDF family zinc efflux transporter CzrB | - |
DQL85_RS11210 | 2163243..2164334 | + | 1092 | WP_000495682.1 | hypothetical protein | - |
- | 2164727..2164782 | + | 56 | - | - | Antitoxin |
DQL85_RS11215 | 2164839..2164943 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
DQL85_RS11220 | 2165041..2165181 | - | 141 | Protein_2072 | helix-turn-helix domain-containing protein | - |
DQL85_RS11230 | 2165620..2165778 | + | 159 | WP_024928151.1 | hypothetical protein | - |
DQL85_RS11235 | 2166226..2166318 | + | 93 | WP_000142674.1 | hypothetical protein | - |
DQL85_RS11240 | 2166439..2167296 | - | 858 | WP_000370930.1 | Cof-type HAD-IIB family hydrolase | - |
DQL85_RS11245 | 2167364..2168146 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T292253 WP_075583739.1 NZ_LS483308:c2164943-2164839 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT292253 NZ_LS483308:2164727-2164782 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|