292250

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2011068..2011482 Replicon chromosome
Accession NZ_LS483308
Organism Staphylococcus aureus strain NCTC13137

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DQL85_RS10310 Protein ID WP_001065046.1
Coordinates 2011231..2011482 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DQL85_RS14365 Protein ID WP_000028424.1
Coordinates 2011068..2011241 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL85_RS10270 2006662..2008323 - 1662 WP_111743876.1 terminase large subunit -
DQL85_RS10275 2008320..2008664 - 345 WP_000402904.1 hypothetical protein -
DQL85_RS10280 2008794..2009093 - 300 WP_000988336.1 HNH endonuclease -
DQL85_RS10285 2009325..2009741 - 417 WP_000590122.1 hypothetical protein -
DQL85_RS10290 2009769..2009969 - 201 WP_000265043.1 DUF1514 family protein -
DQL85_RS10295 2009969..2010118 - 150 WP_000595265.1 transcriptional activator RinB -
DQL85_RS10300 2010115..2010321 - 207 WP_111743877.1 DUF1381 domain-containing protein -
DQL85_RS10305 2010358..2010891 - 534 WP_001061838.1 dUTP diphosphatase -
DQL85_RS14360 2010906..2011067 - 162 WP_000889684.1 hypothetical protein -
DQL85_RS14365 2011068..2011241 - 174 WP_000028424.1 hypothetical protein Antitoxin
DQL85_RS10310 2011231..2011482 - 252 WP_001065046.1 DUF1024 family protein Toxin
DQL85_RS10315 2011475..2011885 - 411 WP_111743878.1 acetyltransferase -
DQL85_RS10320 2011882..2012391 - 510 WP_088811208.1 hypothetical protein -
DQL85_RS10325 2012388..2012795 - 408 WP_088811209.1 hypothetical protein -
DQL85_RS10330 2012792..2013196 - 405 WP_111743879.1 hypothetical protein -
DQL85_RS10335 2013211..2013459 - 249 WP_072716750.1 hypothetical protein -
DQL85_RS10340 2013459..2013713 - 255 WP_000022736.1 DUF3310 domain-containing protein -
DQL85_RS10345 2013713..2014222 - 510 WP_047432426.1 hypothetical protein -
DQL85_RS10350 2014223..2014408 - 186 WP_031873777.1 DUF3113 family protein -
DQL85_RS10355 2014413..2014817 - 405 WP_000049798.1 DUF1064 domain-containing protein -
DQL85_RS10360 2014827..2015048 - 222 WP_001123695.1 DUF3269 family protein -
DQL85_RS10365 2015061..2015219 - 159 WP_111743880.1 hypothetical protein -
DQL85_RS10370 2015216..2016001 - 786 WP_024273306.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / sak / see / hlb / hlb / groEL 1984246..2040333 56087


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.26 Da        Isoelectric Point: 3.7128

>T292250 WP_001065046.1 NZ_LS483308:c2011482-2011231 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT292250 WP_000028424.1 NZ_LS483308:c2011241-2011068 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References