Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1987878..1988185 | Replicon | chromosome |
| Accession | NZ_LS483308 | ||
| Organism | Staphylococcus aureus strain NCTC13137 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DQL85_RS10175 | Protein ID | WP_011447039.1 |
| Coordinates | 1988009..1988185 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1987878..1988017 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL85_RS10115 | 1983443..1983622 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| DQL85_RS10125 | 1983933..1984193 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| DQL85_RS10130 | 1984246..1984596 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DQL85_RS10135 | 1985108..1985443 | - | 336 | Protein_1867 | SH3 domain-containing protein | - |
| DQL85_RS10155 | 1986094..1986585 | - | 492 | WP_000920038.1 | staphylokinase | - |
| DQL85_RS10160 | 1986776..1987531 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DQL85_RS10165 | 1987543..1987797 | - | 255 | WP_000611512.1 | phage holin | - |
| DQL85_RS10170 | 1987849..1987956 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - | 1987878..1988017 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 1987878..1988017 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 1987878..1988017 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 1987878..1988017 | + | 140 | NuclAT_0 | - | Antitoxin |
| DQL85_RS10175 | 1988009..1988185 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| DQL85_RS10180 | 1988388..1989161 | - | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
| DQL85_RS10185 | 1989582..1989956 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| DQL85_RS10190 | 1990012..1990299 | - | 288 | WP_001040255.1 | hypothetical protein | - |
| DQL85_RS10195 | 1990346..1990498 | - | 153 | WP_111743871.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / see / hlb / hlb / groEL | 1984246..2040333 | 56087 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292247 WP_011447039.1 NZ_LS483308:c1988185-1988009 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT292247 NZ_LS483308:1987878-1988017 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|