Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1836597..1836777 | Replicon | chromosome |
| Accession | NZ_LS483308 | ||
| Organism | Staphylococcus aureus strain NCTC13137 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL85_RS09150 | Protein ID | WP_001801861.1 |
| Coordinates | 1836597..1836692 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1836720..1836777 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL85_RS09105 | 1831638..1832264 | + | 627 | WP_000669019.1 | hypothetical protein | - |
| DQL85_RS09110 | 1832305..1832646 | + | 342 | WP_000627548.1 | DUF3969 family protein | - |
| DQL85_RS09115 | 1832747..1833319 | + | 573 | WP_000414212.1 | hypothetical protein | - |
| DQL85_RS09120 | 1833517..1834074 | - | 558 | WP_000864138.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL85_RS09130 | 1834445..1834621 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| DQL85_RS09135 | 1834632..1835015 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| DQL85_RS09140 | 1835700..1836146 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| DQL85_RS09150 | 1836597..1836692 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1836720..1836777 | - | 58 | - | - | Antitoxin |
| DQL85_RS09155 | 1836815..1836916 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| DQL85_RS09160 | 1836894..1837076 | - | 183 | Protein_1719 | transposase | - |
| DQL85_RS09165 | 1837264..1837638 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| DQL85_RS09170 | 1837660..1838007 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
| DQL85_RS09175 | 1838217..1838660 | - | 444 | WP_006190573.1 | DUF1433 domain-containing protein | - |
| DQL85_RS09180 | 1839308..1840426 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1829078..1871472 | 42394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292245 WP_001801861.1 NZ_LS483308:1836597-1836692 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT292245 NZ_LS483308:c1836777-1836720 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|