Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2441204..2441388 | Replicon | chromosome |
| Accession | NC_020566 | ||
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | SAI5S5_RS12350 | Protein ID | WP_000482652.1 |
| Coordinates | 2441281..2441388 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2441204..2441264 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI5S5_RS12325 | 2436659..2436826 | - | 168 | Protein_2327 | hypothetical protein | - |
| SAI5S5_RS12335 | 2437057..2438790 | - | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
| SAI5S5_RS12340 | 2438815..2440578 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2441204..2441264 | + | 61 | - | - | Antitoxin |
| SAI5S5_RS12350 | 2441281..2441388 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAI5S5_RS12355 | 2441522..2441908 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| SAI5S5_RS12360 | 2442176..2443318 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| SAI5S5_RS12365 | 2443378..2444037 | + | 660 | WP_000831302.1 | hypothetical protein | - |
| SAI5S5_RS12370 | 2444219..2445430 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| SAI5S5_RS12375 | 2445553..2446026 | - | 474 | WP_015445934.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T29224 WP_000482652.1 NC_020566:c2441388-2441281 [Staphylococcus aureus subsp. aureus ST228]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29224 NC_020566:c2441388-2441281 [Staphylococcus aureus subsp. aureus ST228]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29224 NC_020566:2441204-2441264 [Staphylococcus aureus subsp. aureus ST228]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|