Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3571882..3572576 Replicon chromosome
Accession NZ_LS483303
Organism Escherichia coli strain NCTC9967

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag DQM88_RS18360 Protein ID WP_001263493.1
Coordinates 3571882..3572280 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag DQM88_RS18365 Protein ID WP_000554757.1
Coordinates 3572283..3572576 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM88_RS18330 3566882..3568126 - 1245 WP_000189541.1 esterase FrsA -
- 3567542..3567622 - 81 NuclAT_10 - -
- 3567542..3567622 - 81 NuclAT_10 - -
- 3567542..3567622 - 81 NuclAT_10 - -
- 3567542..3567622 - 81 NuclAT_10 - -
DQM88_RS18335 3568218..3568676 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
DQM88_RS18340 3568937..3570394 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
DQM88_RS18345 3570451..3570972 - 522 Protein_3338 peptide chain release factor H -
DQM88_RS18350 3570971..3571174 - 204 Protein_3339 RNA ligase RtcB family protein -
DQM88_RS18355 3571420..3571872 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
DQM88_RS18360 3571882..3572280 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
DQM88_RS18365 3572283..3572576 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
DQM88_RS18370 3572628..3573683 - 1056 WP_094318827.1 DNA polymerase IV -
DQM88_RS18375 3573754..3574677 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
DQM88_RS18380 3574680..3575543 - 864 WP_094318826.1 flagellar motor stator protein MotA -
DQM88_RS18385 3575556..3576272 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
DQM88_RS18390 3576292..3576759 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / gtrB 3531067..3572576 41509


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T292234 WP_001263493.1 NZ_LS483303:c3572280-3571882 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT292234 WP_000554757.1 NZ_LS483303:c3572576-3572283 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References