Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 696906..697599 | Replicon | chromosome |
Accession | NZ_LS483303 | ||
Organism | Escherichia coli strain NCTC9967 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | DQM88_RS03645 | Protein ID | WP_000415584.1 |
Coordinates | 696906..697202 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | DQM88_RS03650 | Protein ID | WP_000650107.1 |
Coordinates | 697204..697599 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM88_RS03605 | 691994..692308 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
DQM88_RS03610 | 692339..692920 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
DQM88_RS03620 | 693239..693571 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
DQM88_RS03625 | 693617..694966 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
DQM88_RS03630 | 694963..695622 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
DQM88_RS03635 | 695774..696166 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
DQM88_RS03640 | 696219..696701 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
DQM88_RS03645 | 696906..697202 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
DQM88_RS03650 | 697204..697599 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
DQM88_RS03660 | 697732..699339 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
DQM88_RS03665 | 699477..701735 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T292224 WP_000415584.1 NZ_LS483303:696906-697202 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT292224 WP_000650107.1 NZ_LS483303:697204-697599 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|