Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2446438..2446622 | Replicon | chromosome |
Accession | NZ_LS483302 | ||
Organism | Staphylococcus aureus strain NCTC8726 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DQL80_RS12600 | Protein ID | WP_000482647.1 |
Coordinates | 2446515..2446622 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2446438..2446498 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL80_RS12575 | 2441953..2442120 | - | 168 | WP_111680597.1 | hypothetical protein | - |
DQL80_RS12585 | 2442346..2444079 | - | 1734 | WP_000488491.1 | ABC transporter ATP-binding protein/permease | - |
DQL80_RS12590 | 2444128..2445867 | - | 1740 | WP_001064832.1 | ABC transporter ATP-binding protein/permease | - |
- | 2446438..2446498 | + | 61 | - | - | Antitoxin |
DQL80_RS12600 | 2446515..2446622 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DQL80_RS12605 | 2446756..2447142 | - | 387 | WP_000779354.1 | flippase GtxA | - |
DQL80_RS12610 | 2447410..2448552 | + | 1143 | WP_111680598.1 | glycerate kinase | - |
DQL80_RS12615 | 2448612..2449271 | + | 660 | WP_111680599.1 | hypothetical protein | - |
DQL80_RS12620 | 2449451..2450662 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
DQL80_RS12625 | 2450785..2451258 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T292222 WP_000482647.1 NZ_LS483302:c2446622-2446515 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT292222 NZ_LS483302:2446438-2446498 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|