Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprA2AS/- |
Location | 1985064..1985363 | Replicon | chromosome |
Accession | NZ_LS483302 | ||
Organism | Staphylococcus aureus strain NCTC8726 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DQL80_RS10070 | Protein ID | WP_011447039.1 |
Coordinates | 1985187..1985363 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1985064..1985123 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL80_RS10010 | 1980096..1980343 | + | 248 | Protein_1847 | sphingomyelin phosphodiesterase | - |
DQL80_RS10015 | 1980665..1980844 | + | 180 | WP_000669789.1 | hypothetical protein | - |
DQL80_RS10025 | 1981155..1981415 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DQL80_RS10030 | 1981468..1981818 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DQL80_RS10035 | 1982330..1982668 | - | 339 | Protein_1851 | SH3 domain-containing protein | - |
DQL80_RS10050 | 1983272..1983763 | - | 492 | WP_000920041.1 | staphylokinase | - |
DQL80_RS10055 | 1983954..1984709 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL80_RS10060 | 1984721..1984975 | - | 255 | WP_000611512.1 | phage holin | - |
DQL80_RS10065 | 1985027..1985134 | + | 108 | WP_031790389.1 | hypothetical protein | - |
- | 1985056..1985195 | + | 140 | NuclAT_0 | - | - |
- | 1985056..1985195 | + | 140 | NuclAT_0 | - | - |
- | 1985056..1985195 | + | 140 | NuclAT_0 | - | - |
- | 1985056..1985195 | + | 140 | NuclAT_0 | - | - |
- | 1985064..1985123 | + | 60 | - | - | Antitoxin |
DQL80_RS10070 | 1985187..1985363 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DQL80_RS10075 | 1985513..1985809 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DQL80_RS10080 | 1985867..1986154 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DQL80_RS10085 | 1986201..1986353 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DQL80_RS10090 | 1986343..1990128 | - | 3786 | WP_111680465.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1981468..2031966 | 50498 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292219 WP_011447039.1 NZ_LS483302:c1985363-1985187 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 60 bp
>AT292219 NZ_LS483302:1985064-1985123 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTA
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|