Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1840515..1840695 | Replicon | chromosome |
| Accession | NZ_LS483302 | ||
| Organism | Staphylococcus aureus strain NCTC8726 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DQL80_RS09110 | Protein ID | WP_001801861.1 |
| Coordinates | 1840515..1840610 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1840638..1840695 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL80_RS09065 | 1835848..1836843 | + | 996 | WP_111680416.1 | DUF4352 domain-containing protein | - |
| DQL80_RS09070 | 1836919..1837542 | + | 624 | WP_111680417.1 | hypothetical protein | - |
| DQL80_RS09075 | 1837583..1837924 | + | 342 | WP_111680418.1 | DUF3969 family protein | - |
| DQL80_RS09080 | 1838025..1838597 | + | 573 | WP_111680419.1 | hypothetical protein | - |
| DQL80_RS09090 | 1839117..1839293 | - | 177 | WP_029550358.1 | hypothetical protein | - |
| DQL80_RS09095 | 1839304..1839687 | - | 384 | WP_111680420.1 | hypothetical protein | - |
| DQL80_RS09105 | 1840077..1840370 | - | 294 | WP_111680421.1 | transposase | - |
| DQL80_RS09110 | 1840515..1840610 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1840638..1840695 | - | 58 | - | - | Antitoxin |
| DQL80_RS09115 | 1840733..1840834 | + | 102 | WP_064134509.1 | hypothetical protein | - |
| DQL80_RS09120 | 1840812..1841072 | - | 261 | Protein_1714 | transposase | - |
| DQL80_RS09125 | 1841269..1842471 | - | 1203 | WP_111680422.1 | restriction endonuclease subunit S | - |
| DQL80_RS09130 | 1842464..1844020 | - | 1557 | WP_111680423.1 | type I restriction-modification system subunit M | - |
| DQL80_RS09135 | 1844129..1844308 | - | 180 | Protein_1717 | hypothetical protein | - |
| DQL80_RS09140 | 1844373..1845092 | - | 720 | WP_111680424.1 | serine protease | - |
| DQL80_RS09145 | 1845194..1845309 | + | 116 | Protein_1719 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T292217 WP_001801861.1 NZ_LS483302:1840515-1840610 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT292217 NZ_LS483302:c1840695-1840638 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|