Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1840515..1840695 Replicon chromosome
Accession NZ_LS483302
Organism Staphylococcus aureus strain NCTC8726

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL80_RS09110 Protein ID WP_001801861.1
Coordinates 1840515..1840610 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1840638..1840695 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL80_RS09065 1835848..1836843 + 996 WP_111680416.1 DUF4352 domain-containing protein -
DQL80_RS09070 1836919..1837542 + 624 WP_111680417.1 hypothetical protein -
DQL80_RS09075 1837583..1837924 + 342 WP_111680418.1 DUF3969 family protein -
DQL80_RS09080 1838025..1838597 + 573 WP_111680419.1 hypothetical protein -
DQL80_RS09090 1839117..1839293 - 177 WP_029550358.1 hypothetical protein -
DQL80_RS09095 1839304..1839687 - 384 WP_111680420.1 hypothetical protein -
DQL80_RS09105 1840077..1840370 - 294 WP_111680421.1 transposase -
DQL80_RS09110 1840515..1840610 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1840638..1840695 - 58 - - Antitoxin
DQL80_RS09115 1840733..1840834 + 102 WP_064134509.1 hypothetical protein -
DQL80_RS09120 1840812..1841072 - 261 Protein_1714 transposase -
DQL80_RS09125 1841269..1842471 - 1203 WP_111680422.1 restriction endonuclease subunit S -
DQL80_RS09130 1842464..1844020 - 1557 WP_111680423.1 type I restriction-modification system subunit M -
DQL80_RS09135 1844129..1844308 - 180 Protein_1717 hypothetical protein -
DQL80_RS09140 1844373..1845092 - 720 WP_111680424.1 serine protease -
DQL80_RS09145 1845194..1845309 + 116 Protein_1719 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292217 WP_001801861.1 NZ_LS483302:1840515-1840610 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT292217 NZ_LS483302:c1840695-1840638 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References