Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2319719..2319998 | Replicon | chromosome |
Accession | NZ_LS483301 | ||
Organism | Staphylococcus aureus strain NCTC13394 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DQL88_RS12370 | Protein ID | WP_001802298.1 |
Coordinates | 2319894..2319998 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2319719..2319898 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL88_RS12350 | 2315918..2316583 | - | 666 | WP_045177733.1 | SDR family oxidoreductase | - |
DQL88_RS12355 | 2316735..2317055 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DQL88_RS12360 | 2317057..2318037 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
DQL88_RS12365 | 2318303..2319394 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2319719..2319898 | + | 180 | - | - | Antitoxin |
DQL88_RS12370 | 2319894..2319998 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DQL88_RS15640 | 2320159..2320642 | - | 484 | Protein_2275 | recombinase family protein | - |
DQL88_RS12380 | 2320685..2321821 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
DQL88_RS12385 | 2322110..2322202 | + | 93 | WP_001790138.1 | hypothetical protein | - |
DQL88_RS12395 | 2322655..2323827 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2322655..2323827 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T292209 WP_001802298.1 NZ_LS483301:c2319998-2319894 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT292209 NZ_LS483301:2319719-2319898 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|