Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 2128703..2129010 | Replicon | chromosome |
Accession | NZ_LS483301 | ||
Organism | Staphylococcus aureus strain NCTC13394 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DQL88_RS11185 | Protein ID | WP_011447039.1 |
Coordinates | 2128834..2129010 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 2128703..2128842 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL88_RS11130 | 2123740..2124090 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DQL88_RS11135 | 2124200..2125372 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
DQL88_RS11145 | 2125933..2126268 | - | 336 | Protein_2047 | SH3 domain-containing protein | - |
DQL88_RS11165 | 2126919..2127410 | - | 492 | WP_000920038.1 | staphylokinase | - |
DQL88_RS11170 | 2127601..2128356 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DQL88_RS11175 | 2128368..2128622 | - | 255 | WP_061642081.1 | phage holin | - |
DQL88_RS11180 | 2128674..2128781 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- | 2128703..2128842 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2128703..2128842 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2128703..2128842 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2128703..2128842 | + | 140 | NuclAT_0 | - | Antitoxin |
DQL88_RS11185 | 2128834..2129010 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DQL88_RS11190 | 2129119..2129892 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
DQL88_RS11195 | 2130265..2130639 | - | 375 | WP_061642082.1 | hypothetical protein | - |
DQL88_RS11200 | 2130695..2130982 | - | 288 | WP_001262621.1 | hypothetical protein | - |
DQL88_RS11205 | 2131028..2131180 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2123740..2196582 | 72842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T292204 WP_011447039.1 NZ_LS483301:c2129010-2128834 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT292204 NZ_LS483301:2128703-2128842 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|