Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1958596..1958778 Replicon chromosome
Accession NZ_LS483301
Organism Staphylococcus aureus strain NCTC13394

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag DQL88_RS10055 Protein ID WP_001801861.1
Coordinates 1958596..1958691 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1958719..1958778 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL88_RS10005 1954256..1954882 + 627 WP_000669046.1 hypothetical protein -
DQL88_RS10010 1954923..1955267 + 345 WP_000627551.1 DUF3969 family protein -
DQL88_RS10015 1955365..1955916 + 552 WP_000414205.1 hypothetical protein -
DQL88_RS10020 1956134..1956775 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
DQL88_RS10025 1956889..1957074 - 186 WP_000809857.1 hypothetical protein -
DQL88_RS10030 1957076..1957252 - 177 WP_000375476.1 hypothetical protein -
DQL88_RS10035 1957263..1957646 - 384 WP_000070811.1 hypothetical protein -
DQL88_RS10045 1958250..1958393 - 144 WP_001549059.1 transposase -
DQL88_RS10055 1958596..1958691 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1958719..1958778 - 60 - - Antitoxin
DQL88_RS10060 1958814..1958915 + 102 WP_001791893.1 hypothetical protein -
DQL88_RS10065 1958893..1959069 - 177 Protein_1886 transposase -
DQL88_RS10070 1959263..1959640 - 378 WP_001037045.1 DUF1433 domain-containing protein -
DQL88_RS10075 1960420..1962024 - 1605 WP_000284571.1 IS1182-like element IS1182 family transposase -
DQL88_RS10080 1962181..1963329 - 1149 Protein_1889 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / lukD / hlgA 1951695..2031650 79955


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T292202 WP_001801861.1 NZ_LS483301:1958596-1958691 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT292202 NZ_LS483301:c1958778-1958719 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References