Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3709070..3709764 | Replicon | chromosome |
| Accession | NZ_LS483297 | ||
| Organism | Escherichia coli strain NCTC11023 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | DQM98_RS19335 | Protein ID | WP_001263493.1 |
| Coordinates | 3709070..3709468 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | DQM98_RS19340 | Protein ID | WP_000554757.1 |
| Coordinates | 3709471..3709764 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM98_RS19305 | 3704070..3705314 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3704730..3704810 | - | 81 | NuclAT_8 | - | - |
| - | 3704730..3704810 | - | 81 | NuclAT_8 | - | - |
| - | 3704730..3704810 | - | 81 | NuclAT_8 | - | - |
| - | 3704730..3704810 | - | 81 | NuclAT_8 | - | - |
| DQM98_RS19310 | 3705406..3705864 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| DQM98_RS19315 | 3706125..3707582 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| DQM98_RS19320 | 3707639..3708160 | - | 522 | Protein_3533 | peptide chain release factor H | - |
| DQM98_RS19325 | 3708159..3708362 | - | 204 | Protein_3534 | RNA ligase RtcB family protein | - |
| DQM98_RS19330 | 3708608..3709060 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| DQM98_RS19335 | 3709070..3709468 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| DQM98_RS19340 | 3709471..3709764 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| DQM98_RS19345 | 3709816..3710871 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| DQM98_RS19350 | 3710942..3711727 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| DQM98_RS19355 | 3711699..3713411 | + | 1713 | Protein_3540 | flagellar biosynthesis protein FlhA | - |
| DQM98_RS19360 | 3713627..3714124 | - | 498 | WP_111732616.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3660750..3724333 | 63583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T292186 WP_001263493.1 NZ_LS483297:c3709468-3709070 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|