Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3709070..3709764 Replicon chromosome
Accession NZ_LS483297
Organism Escherichia coli strain NCTC11023

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag DQM98_RS19335 Protein ID WP_001263493.1
Coordinates 3709070..3709468 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag DQM98_RS19340 Protein ID WP_000554757.1
Coordinates 3709471..3709764 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM98_RS19305 3704070..3705314 - 1245 WP_000189541.1 esterase FrsA -
- 3704730..3704810 - 81 NuclAT_8 - -
- 3704730..3704810 - 81 NuclAT_8 - -
- 3704730..3704810 - 81 NuclAT_8 - -
- 3704730..3704810 - 81 NuclAT_8 - -
DQM98_RS19310 3705406..3705864 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
DQM98_RS19315 3706125..3707582 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
DQM98_RS19320 3707639..3708160 - 522 Protein_3533 peptide chain release factor H -
DQM98_RS19325 3708159..3708362 - 204 Protein_3534 RNA ligase RtcB family protein -
DQM98_RS19330 3708608..3709060 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
DQM98_RS19335 3709070..3709468 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
DQM98_RS19340 3709471..3709764 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
DQM98_RS19345 3709816..3710871 - 1056 WP_001226164.1 DNA polymerase IV -
DQM98_RS19350 3710942..3711727 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
DQM98_RS19355 3711699..3713411 + 1713 Protein_3540 flagellar biosynthesis protein FlhA -
DQM98_RS19360 3713627..3714124 - 498 WP_111732616.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3660750..3724333 63583


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T292186 WP_001263493.1 NZ_LS483297:c3709468-3709070 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT292186 WP_000554757.1 NZ_LS483297:c3709764-3709471 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References